PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco009397.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family SRS
Protein Properties Length: 335aa    MW: 34947.1 Da    PI: 8.4123
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco009397.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702210.83.4e-651002505153
       DUF702   5 tasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa..aeaaskrkrelkskkqsalsstklssaeskkel 100
                  ++sCqdCGnqakkdCah+RCRtCCksrgf+CathvkstWvpaa+rr+rq+q++ + +   +s+  a+ +++r+r+ +s+    ++s     +      
  Aco009397.1 100 GVSCQDCGNQAKKDCAHQRCRTCCKSRGFHCATHVKSTWVPAARRRDRQHQHQLQLAALPSSSspADPSKRRPRDRRSSLPPPSTSGGGGGGGLGAGA 197
                  679*********************************************88777665555544422444555556554444444444444445555666 PP

       DUF702 101 etsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153
                    +++P+evsseavfrcvr++ vd++e+e+aYq++vsigGhvfkGiL+dqG++
  Aco009397.1 198 VEARFPAEVSSEAVFRCVRIGPVDEAEDEYAYQATVSIGGHVFKGILRDQGPD 250
                  6777***********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051424.5E-62100250IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016233.0E-27102144IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016245.4E-25201249IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010252Biological Processauxin homeostasis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048479Biological Processstyle development
GO:0048480Biological Processstigma development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MAGFPLGGGG SSGHIPTSRD DQNPLPPDTF FLYARAGGTG TSGFQLWQQQ QQQQQQQQQQ  60
QQQQAQFYSS SGAILSFSHE ASASGSGQSG GRYGGGGGSG VSCQDCGNQA KKDCAHQRCR  120
TCCKSRGFHC ATHVKSTWVP AARRRDRQHQ HQLQLAALPS SSSPADPSKR RPRDRRSSLP  180
PPSTSGGGGG GGLGAGAVEA RFPAEVSSEA VFRCVRIGPV DEAEDEYAYQ ATVSIGGHVF  240
KGILRDQGPD LSSYSYSGYH YHTQPPQPGE SSSSAAAAAA AAAASAEAAI TSASAAAAPA  300
AVMDPYPTPL SAFAAGTQFF PQQHHHHHHH HPRS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18997GGRYGGGGG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00613PBMTransfer from AT3G51060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009400795.11e-72PREDICTED: protein SHI RELATED SEQUENCE 1-like
RefseqXP_009400794.11e-72PREDICTED: protein SHI RELATED SEQUENCE 1-like
TrEMBLM0SPV93e-73M0SPV9_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P17960_0017e-73(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP135435124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75520.12e-35SHI-related sequence 5